GLOW Blend – BPC-157 (10 mg) / TB-500 (10 mg) / GHK-Cu (50 mg) — 99%+ Pure Research Peptide Blend for Sale
Elevate your in-vitro work with GLOW Blend from Peptide Tech — a premium RUO combination of three widely studied peptides: BPC-157 (pentadecapeptide), TB-500 (thymosin β4 peptide), and GHK-Cu (copper tripeptide complex). Formulated for ≥99% purity (MS & HPLC verified), this blend is produced under GMP-aligned conditions and lyophilized to help preserve integrity during storage and shipment. Designed strictly for laboratory research, GLOW Blend provides a convenient single-vial format for comparative, combinatorial, and dose-response experiments exploring cell migration, actin dynamics, extracellular matrix (ECM) remodeling, and angiogenesis signaling — without any claims of therapeutic or human use.
— — — — — — — — — — — — — — — — — — — — — — — —
BPC-157 (Component A)
• CAS Number: 137525-51-0
• Chemical Name: Stable gastric pentadecapeptide BPC-157
• PubChem CID: [9941957] PubChem
• Molecular Formula: C62H98N16O22
• Molecular Weight: ≈1419.5 g/mol
• Physical Appearance: White lyophilized powder
• Sequence: Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val (GEPPPGKPADDAGLV)
• Container: Glass 3 mL vial (sealed, lyophilized)
• Purity: ≥99% (MS & HPLC verified)
• Solubility: Soluble in sterile water or aqueous buffers; optimize pH/ionic strength for target assay
• Structure image
TB-500 (Component B) — Thymosin β4 Peptide*
• CAS Number: 77591-33-4
• Chemical Name: Thymosin β4 (INN: timbetasin)
• PubChem CID: [16132341] (timbetasin) ) PubChem
• Molecular Formula: C212H350N56O78S
• Molecular Weight: ≈4,92–4,98 kDa (sequence dependent)
• Physical Appearance: White lyophilized powder
• Sequence (human Tβ4, 43 aa): SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Wikipedia
• Container: Glass 3 mL vial (lyophilized)
• Purity: ≥99% (MS & HPLC verified)
• Solubility: Soluble in sterile water or buffered saline
• Structure reference UniProtEMBL-EBI
*Note: “TB-500” is commonly used in research markets as a synonym for thymosin β4. This product uses full-length Tβ4 unless otherwise indicated.
GHK-Cu (Component C) — Copper(II)-Gly-His-Lys Complex
• CAS Number: 89030-95-5 (complex)
• Chemical Name: Glycyl-L-histidyl-L-lysine copper(II)
• PubChem CID: [71587328] (Prezatide copper) or [378611] (Cu-GHK) PubChem
• Molecular Formula: C14H24CuN6O4
• Molecular Weight: ≈403.9 g/mol
• Physical Appearance: Blue-tinged/white lyophilized powder (complex may appear faintly blue)
• Sequence: Gly-His-Lys complexed with Cu(II)
• Container: Glass 3 mL vial (lyophilized)
• Purity: ≥99% (MS & HPLC verified)
• Solubility: Readily soluble in water; chelation state can vary with pH/ligands
• Structure image link (PubChem): https://pubchem.ncbi.nlm.nih.gov/compound/71587328
Key Features — Why Peptide Tech
• Same-Day Shipping from the USA (Mon–Fri)
• GMP-Aligned Lyophilized Peptides
• USA-Made with traceable supply chain
• 24/7 Support and Price-Match Guarantee
• Batch Tracking + QR Verification (COA download per lot)
• 3rd-Party U.S. Labs test every lot for purity, quantity, endotoxin
• Cold-Chain Shipping always — no paid upgrade required
• Worldwide Shipping with compliant documentation
• All Major Payments Accepted; text/email order updates
• 2-Day FedEx/UPS Standard; lowest overnight rates
• Largest Variety of peptides & bioregulators (RUO)
Potential Applications in Research (RUO — no human/animal use)
• Endothelial tube-formation and VEGFR2 signaling assays using HUVECs or comparable cell lines to study pro-angiogenic pathway activation by BPC-157 in vitro. PubMed
• Tendon/mesenchymal cell migration and adhesion models (e.g., transwell, scratch assays) to analyze focal adhesion kinase (FAK)/paxillin activation in response to BPC-157 exposure. PubMed
• Actin-dynamics and G-actin sequestration workflows (fluorescence-based polymerization assays) for mechanistic studies with thymosin β4 (TB-500). PubMed
• Endothelial cell chemotaxis/migration screens (Boyden chamber/scratch) to quantify thymosin β4–driven motility and matrix remodeling in vitro. PubMed
• ECM remodeling and collagen-synthesis assays in dermal fibroblasts (e.g., Sircol/ELISA/qPCR) to profile GHK-Cu–induced collagen expression and related ECM markers. PubMed
Citations
• Chang, Chung-Hsun, et al. “The Promoting Effect of Pentadecapeptide BPC 157 on Tendon Healing Involves Tendon Outgrowth, Cell Survival, and Cell Migration.” Journal of Applied Physiology, vol. 110, no. 3, 2011, pp. 774–780. https://doi.org/10.1152/japplphysiol.00945.2010. PubMed
• Hsieh, Ming-Jer, et al. “Therapeutic Potential of Pro-Angiogenic BPC157 Is Associated with VEGFR2 Activation and Up-Regulation.” Journal of Molecular Medicine, vol. 95, no. 3, 2017, pp. 323–333. https://doi.org/10.1007/s00109-016-1488-y. PubMed
• Malinda, K. M., et al. “Thymosin Beta 4 Stimulates Directional Migration of Human Umbilical Vein Endothelial Cells.” FASEB Journal, vol. 11, no. 6, 1997, pp. 474–481. https://doi.org/10.1096/fasebj.11.6.9194528. PubMed
• Safer, D., et al. “Thymosin Beta 4 Binds Actin in an Extended Conformation and Contacts Both the Barbed and Pointed Ends.” Biochemistry, vol. 36, no. 19, 1997, pp. 5806–5816. https://doi.org/10.1021/bi970185v. PubMed
• Maquart, F. X., et al. “Stimulation of Collagen Synthesis in Fibroblast Cultures by the Tripeptide-Copper Complex Glycyl-L-Histidyl-L-Lysine-Cu2+.” FEBS Letters, vol. 238, no. 2, 1988, pp. 343–346. https://doi.org/10.1016/0014-5793(88)80509-X. PubMed
Quality, Storage & Handling
• Lot-Specific COA: QR code links to results for identity, purity (HPLC), MS, quantity, and endotoxin (USP LAL).
• Storage: Store lyophilized vials at 2–8 °C; for longer term, ≤-20 °C, desiccated and protected from light. After reconstitution, aliquot and store at ≤-20 °C; minimize freeze–thaw.
• Reconstitution Tips: Use sterile, nuclease-free water or appropriate buffer; for GHK-Cu, maintain neutral pH to preserve complexation state.
Shipping & Fulfillment
• Cold-chain packaging with validated insulation and phase-change coolant. Standard 2-Day service included; overnight options available at the industry’s lowest rates.
Compliance (Read Before Ordering)
• For Laboratory Research Only. Not a drug, food, cosmetic, or household chemical. No human or animal use; no clinical, veterinary, or diagnostic applications.
• Buyers warrant they are qualified researchers handling RUO materials under applicable laws and institutional guidelines.
FAQ
• What is in the vial? One lyophilized blend containing BPC-157 (10 mg), TB-500/thymosin β4 (10 mg), and GHK-Cu (50 mg).
• Endotoxin spec? Each lot tested; results provided on COA (QR-linked).
• Can I buy components separately? Yes — see individual RUO listings for BPC-157, Tβ4/TB-500, and GHK-Cu.
• Human/therapeutic use? No. RUO only — not for human/animal use or any therapeutic purpose.
Related Products
Browse more in Peptides.
Always read the label and use products as directed. Consult a qualified professional where appropriate.













