FOXO4-DRI 10 mg (FOXO4 D-retro-inverso peptide) from Peptide Tech is a premium, lyophilized research-use-only (RUO) peptide manufactured at ≥99% purity (HPLC & MS verified). This D-amino-acid sequence is formatted for reproducible in-vitro protein–protein interaction studies (FOXO4–p53), senescence pathway models, and analytical method development—backed by batch traceability, third-party testing, and validated cold-chain logistics.

Specifications

Property	Details
Product	FOXO4-DRI — lyophilized peptide (10 mg)
Chemical Name	FOXO4 D-retro-inverso peptide (research grade)
Synonyms	FOXO4 D-Retro-Inverso; FOXO4/p53 Interaction Peptide; FOXO4-DRI acetate (salt variant)
Sequence (DRI)	LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP — all residues in D-configuration
CAS Number	2460055-10-9 (free base)
PubChem CID	Not assigned for this research peptide
Molecular Formula	C₂₂₈H₃₈₈N₈₆O₆₄ (free base; salt/lot may vary—see COA)
Molecular Weight	~ 5,36x kDa (counter-ion dependent—see COA)
Appearance	White to off-white lyophilized powder
Content per Vial	10 mg
Container	3 mL Type I glass vial; butyl stopper; flip-off seal
Purity / Identity	≥99% by HPLC; identity by MS (batch COA via on-vial QR)
Counter-ion	Typically acetate unless otherwise specified on the COA
Solubility	Soluble in sterile water or neutral buffers; for higher concentrations, pre-wet with ≤0.1% acetic acid or a small volume of water before bringing to final buffer. If required by your SOP, 0.22 µm filter after dissolution.
Storage (lyophilized)	−20 °C long-term; store desiccated and protected from light
After Reconstitution	Aliquot; store at ≤ −20 °C (or −80 °C per SOP); avoid repeated freeze–thaw cycles
Intended Use	RUO only. Not for human or animal use.

Molecular Structure

No PubChem CID is currently assigned for FOXO4-DRI; structural depictions vary by variant and counter-ion.
Refer to the lot COA for exact composition and analytical confirmations.

Reference identifier: CAS 2460055-10-9 (free base). Verify mass/formula on your lot COA.

Key Features of Peptide Tech

Same-Day Shipping (Mon–Fri, on in-stock items)
GMP-Aligned lyophilization & documentation
USA-Made peptides
24/7 Support & Price Match Guarantee
Batch QR for instant COA & chain-of-custody verification
3rd-Party U.S. Lab Testing — purity, quantity, endotoxin
Cold-Chain Shipping — Always (no paid upgrade)
Worldwide Shipping; all major payments accepted
Text & Email order updates; 2-Day FedEx/UPS standard with low-cost overnight
Largest Variety of peptides & bioregulators

Potential Applications in Research (RUO)

Strictly for laboratory research. No health, diagnostic, or therapeutic claims.

FOXO4–p53 interaction assays — competitive binding (pull-down, fluorescence anisotropy, ITC) to quantify displacement of FOXO4 from p53.
In-vitro senescence models — evaluate p53 localization, caspase-3/7 activation, SA-β-gal staining, and SASP gene panels under controlled induction protocols.
Selectivity profiling — compare activity across FOXO family domains; assess influence of p53 post-translational states on binding.
Method development — establish RP-HPLC/LC–MS(/MS) identity, purity, recovery, and forced-degradation stability across buffers and temperatures.

Quality, Storage & Handling

Every lot is confirmed by HPLC (purity) and MS (identity); the on-vial QR links to the batch COA. Independent U.S. labs verify purity, quantity, and endotoxin.

Reconstitution: Bring vial to room temp; add sterile water or buffer to the vial wall and gently swirl/invert. Avoid vigorous vortexing; brief sonication can help stubborn pellets.
Aliquoting: Prepare single-use aliquots immediately after dissolving to minimize freeze–thaw exposure.
Controls: Include sequence-scrambled or D/L control peptides per your SOP for mechanistic interpretation.

Shipping & Fulfillment

Ships with validated cold-chain packaging. In-stock orders placed before the daily cutoff ship the same day. 2-Day FedEx/UPS is standard, with overnight options available. Automated text/email updates included; international shipping available where permitted.

Compliance & RUO Disclaimer

For laboratory research only. Not a drug, cosmetic, food, or household chemical. Not for human or animal use, ingestion, diagnostic, or therapeutic applications. Purchasers warrant appropriate qualifications and compliance with applicable regulations and institutional policies.

FAQs

Is this the TAT-fused version used in some studies?: Unless stated on the COA, this listing is the FOXO4-DRI core peptide (no CPP). Some publications used a TAT fusion for uptake; custom variants may be available upon request.
Why do formula/mass values vary online?: Values depend on exact sequence variant and counter-ion content. The free-base form is commonly reported around 5.36 kDa; acetate/TFA content or CPP fusions change these numbers. Always confirm on your lot COA.
What purity do you provide?: Each 10 mg vial is ≥99% by HPLC with MS identity confirmation; third-party testing is performed on every lot (COA via on-vial QR).
How should I reconstitute it?: Dissolve in sterile water or a compatible buffer; gently invert until fully dissolved. If sterility is required by your SOP, 0.22 µm filter and aliquot to avoid repeat freeze–thaw.