CJC-1295 (No DAC) Ipamorelin Blend 5mg/5mg

CJC-1295 (No DAC) / Ipamorelin Blend — 5 mg / 5 mg from Peptide Tech pairs a GHRH(1-29) analog (MOD-GRF(1-29), commonly called CJC-1295 no DAC) with a selective GHSR-1a agonist (Ipamorelin). This lyophilized research-use-only (RUO) blend is supplied at ≥99% purity (HPLC & MS verified) and is optimized for in-vitro GPCR signaling, ligand-binding, and pathway-mapping studies that interrogate coordinated activation of the GHRH receptor and the ghrelin receptor under tightly controlled conditions.

 

Specifications

Property	Details
Components	CJC-1295 (No DAC) / MOD-GRF(1-29) — tetrasubstituted GHRH(1-29) analog Ipamorelin — selective GHSR-1a agonist (pentapeptide amide)
Content per Vial	10 mg total: 5 mg MOD-GRF(1-29) + 5 mg Ipamorelin
“No DAC” Note	No Drug Affinity Complex (albumin-binding extender) is present. This is the short-acting research analog.
Sequences	MOD-GRF(1-29) (1-letter): YDADAIFTQSYRKVLAQLSARKLLQDILS-NH2 Key substitutions vs. native GRF(1-29): D-Ala2, Gln8, Ala15, Leu27. Ipamorelin (3-letter): Aib-His-D-2-Nal-D-Phe-Lys-NH2 (non-canonical residues annotated)
Form / Appearance	Lyophilized powders blended in a single vial; white to off-white
Container	3 mL glass vial (10 mg net content: 5 mg + 5 mg)
Purity / Identity	≥99% (HPLC) with MS identity confirmation for each component; batch COA accessible via on-vial QR
Counter-ion	Typically acetate; confirm on lot COA
Solubility	Soluble in sterile water or neutral aqueous buffers; if needed, a minimal 0.1% acetic acid pre-wet can aid dissolution before final dilution. Filter-sterilize (0.22 µm) only if required by SOP.
Intended Use	Laboratory research only (RUO). Not for human or animal use.

Molecular Structure

Key Features of Peptide Tech

• Same-Day Shipping (Mon–Fri, on in-stock items)
• GMP-Aligned Lyophilized Peptides
• USA Made
• 24/7 Support
• Price Match Guarantee
• Batch Tracking with QR Code Verification
• Third-Party U.S. Lab Testing — purity, quantity, endotoxin
• Cold-Chain Shipping — Always (no paid upgrade)
• Worldwide Shipping
• All Major Payments Accepted
• Text & Email Order Updates
• 2-Day FedEx/UPS Standard with low-cost overnight
• Largest Variety of Peptides & Bioregulators

Potential Applications in Research

Strictly in-vitro, cell-based, or biochemical experiments. No health, diagnostic, or therapeutic claims.

• GHRHR (Gs→cAMP) assays — CRE-luciferase or HTRF cAMP in receptor-positive lines using MOD-GRF(1-29) to profile potency/efficacy and desensitization.
• GHSR-1a (Gq/11→Ca²⁺/IP₁) assays — calcium-flux (e.g., Fluo-4) or IP-One HTRF using ipamorelin for selective activation.
• Dual-pathway co-stimulation designs — temporal or ratio-metric dosing of both ligands to map pathway cross-talk (PKA/CREB vs. PLC/ERK) under serum-defined conditions.
• Ligand-binding/competition — membranes or intact cells to determine affinity, association/dissociation kinetics, and rank-order versus related analogs.
• Analytical method development — RP-HPLC/LC–MS/MS for identity, stability, and recovery of each component in single-vial blends.

Quality, Storage & Handling

Every lot is confirmed by HPLC (purity) and MS (identity); batch COA is accessible via the on-vial QR. Independent U.S. labs verify purity, quantity, and endotoxin.

• Storage (lyophilized): −20 °C long-term or 2–8 °C short-term; keep desiccated and protected from light.
• After reconstitution: Aliquot and store at ≤−20 °C (or −80 °C per SOP); avoid repeated freeze–thaw.
• Reconstitution tips: Add sterile water or compatible buffer; gently swirl to dissolve. If required by your SOP, 0.22 µm filter-sterilize after reconstitution.

Shipping & Fulfillment

Ships with validated cold-chain packaging. In-stock orders placed before the daily cutoff ship the same day. 2-Day FedEx/UPS is standard, with overnight options available. Automated text/email updates included; international shipping available where permitted.

Compliance & RUO Disclaimer

For laboratory research only. Not a drug, cosmetic, food, or household chemical. Not for human or animal use, ingestion, diagnostic, or therapeutic applications. Buyers warrant they are qualified to handle RUO materials under applicable laws and institutional guidelines.

FAQs

What does “No DAC” mean here?

It indicates the MOD-GRF(1-29) component does not include the albumin-binding Drug Affinity Complex used to extend in-vivo half-life in other formats. This blend is intended solely for in-vitro work.

How much of each peptide is in the vial?

Each vial contains 5 mg MOD-GRF(1-29) and 5 mg ipamorelin (10 mg total).

How should I prepare it?

Reconstitute the vial with sterile water or a compatible buffer per your SOP. If solubility is slow, a minimal 0.1% acetic acid pre-wet can help; then bring to final volume with buffer. Aliquot and avoid repeat freeze–thaw.

Which in-vitro assays are typical for this blend?

Common RUO applications include GHRHR cAMP assays, GHSR Ca²⁺/IP₁ assays, dual-pathway co-stimulation studies, binding/competition experiments, and LC–MS/HPLC method development.

Explore More

Browse additional research peptides and accessories at Peptide Tech.