TB-500 5 mg (Thymosin β4; INN: timbetasin) from Peptide Tech is a premium, lyophilized research-use-only (RUO) peptide supplied at ≥99% purity (HPLC & MS verified). This naturally occurring 43-residue actin-binding peptide is widely used in in-vitro cytoskeletal, migration, and matrix-remodeling workflows where sequence fidelity, analytical traceability, and cold-chain integrity matter.

Specifications

Property	Details
CAS Number	77591-33-4
Chemical Name	Thymosin β4 (timbetasin)
Synonyms	TB-500; Tβ4; timbetasin
PubChem CID	16132341
Molecular Formula	C₂₁₂H₃₅₀N₅₆O₇₈S
Molecular Weight	≈ 4,963.5 g/mol
Physical Appearance	White to off-white lyophilized powder
Sequence (1-letter)	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 aa)
Container	3 mL glass vial (5 mg net content)
Purity	≥99% verified by HPLC & MS (lot COA via QR)
Solubility	Soluble in sterile water or isotonic buffer; gentle inversion/brief sonication may aid dissolution. Filter-sterilize if required by your assay.
Intended Use	Laboratory research only (RUO). Not for human or animal use.
Composition Note	This TB-500 listing corresponds to full-length human Thymosin β4 (43 aa).

Molecular Structure

Key Features of Peptide Tech

Same-Day Shipping (Mon–Fri, on in-stock items)
GMP-Aligned Lyophilized Peptides
USA Made
24/7 Support
Price Match Guarantee
Batch Tracking with QR Code Verification
3rd-Party U.S. Lab Testing — purity, quantity, endotoxin
Cold-Chain Shipping — Always (no paid upgrade)
Worldwide Shipping
All Major Payments Accepted
Text & Email Order Updates
2-Day FedEx/UPS Shipping Standard
Cheapest Overnight Rates
Largest Variety of Peptides & Bioregulators

Potential Applications in Research

Strictly in-vitro, cellular, or biochemical contexts. No health, diagnostic, or therapeutic claims.

Cytoskeletal/actin dynamics assays (e.g., pyrene-actin polymerization, G-actin sequestration) to quantify Thymosin β4–actin interactions.
Endothelial/epithelial migration models (scratch/transwell) to profile peptide-driven motility and matrix interaction under serum-defined conditions.
Matrix-remodeling readouts (MMP/TIMP, collagen deposition) in fibroblast or endothelial cultures via ELISA, zymography, or imaging.
Proteomics & binding screens (pull-down/co-IP) to map protein partners and downstream signaling nodes in vitro.
Analytical method development (RP-HPLC/LC–MS/MS) for identity confirmation, recovery, and stability across buffers/temperatures.

Quality, Storage & Handling

Every lot is confirmed by HPLC (purity) and MS (identity); batch COA is accessible via on-vial QR. Independent U.S. labs verify purity, quantity, and endotoxin.

Storage (lyophilized): −20 °C long term or 2–8 °C short term; keep desiccated and protected from light.
After reconstitution: Aliquot and store at ≤−20 °C (or −80 °C per SOP); avoid repeated freeze–thaw cycles.
Reconstitution tips: Use sterile water or compatible buffer; gently swirl to dissolve; filter-sterilize only if required by your assay.

Shipping & Fulfillment

Ships with validated cold-chain packaging. In-stock orders placed before the daily cutoff ship the same day. 2-Day FedEx/UPS is standard, with overnight options available. Automated text/email updates included; international shipping available where permitted.

Compliance & RUO Disclaimer

For laboratory research only. Not a drug, cosmetic, food, or household chemical. Not for human or animal use, ingestion, diagnostic, or therapeutic applications. Buyers warrant they are qualified to handle RUO materials under applicable laws and institutional guidelines. COAs available upon request or via QR.

FAQs

Is this listing full-length Thymosin β4?: Yes — this TB-500 corresponds to full-length human Tβ4 (43 aa). Contact support if you need a specific fragment.
What purity do you provide?: Each 5 mg vial is ≥99% by HPLC with MS identity confirmation; third-party testing is performed on every lot (see COA via QR).
How should I reconstitute it?: Use sterile water or a compatible buffer; gently invert until dissolved. If your protocol requires sterility, 0.22 µm filter-sterilize and aliquot to avoid repeat freeze–thaw.
Which in-vitro assays is TB-500 commonly used in?: Typical RUO applications include actin polymerization/sequestration assays, cell-migration models, ECM remodeling panels, and LC–MS/MS identity/stability method development.