LL-37 10 mg (human cathelicidin; hCAP18 C-terminal fragment) from Peptide Tech is a premium, lyophilized research-use-only (RUO) peptide supplied at ≥99% purity (HPLC & MS verified). The 37-residue sequence
[LL-37, 37 aa] is formatted for reproducible in-vitro antimicrobial-peptide mechanism studies, membrane biophysics, receptor pharmacology, and analytical method development—backed by batch traceability, third-party testing, and validated cold-chain shipping.

Specifications

Property	Details
Product	LL-37 — lyophilized peptide, 10 mg
Chemical Name	Human cathelicidin LL-37 (C-terminal fragment of hCAP18)
Synonyms	Cathelicidin; hCAP18 (C-term); Ropocamptide
Sequence	[LL-37, 37 aa] (37 aa)
CAS Number	154947-66-7
PubChem CID	16198951
Molecular Formula	C₂₀₅H₃₄₀N₆₀O₅₃ (free base)
Molecular Weight	≈ 4493.3 g/mol (free base)
Appearance	White to off-white lyophilized powder
Content per Vial	10 mg
Container	3 mL Type I glass vial; butyl stopper; flip-off seal
Purity / Identity	≥99% by HPLC; identity by MS (batch COA via on-vial QR)
Counter-ion	Typically acetate unless otherwise stated on COA
Solubility	Soluble in sterile water or neutral buffers; for higher concentrations, pre-wet with ≤0.1% acetic acid, then bring to final buffer. If sterility is required by your SOP, 0.22 µm filter after dissolution.
Storage (lyophilized)	−20 °C long-term; store desiccated and protected from light
After Reconstitution	Aliquot and store at ≤ −20 °C (or −80 °C per SOP); avoid repeat freeze–thaw cycles
Intended Use	RUO only. Not for human or animal use

Molecular Structure

LL-37 2D structure — PubChem CID 16198951 — View on PubChem (CID 16198951).

Key Features of Peptide Tech

Same-Day Shipping (Mon–Fri, on in-stock items)
GMP-Aligned lyophilization & documentation
USA-Made peptides
24/7 Support & Price Match Guarantee
Batch QR for instant COA & chain-of-custody verification
3rd-Party U.S. Lab Testing — purity, quantity, endotoxin
Cold-Chain Shipping — Always (no paid upgrade)
Worldwide Shipping; all major payments accepted
Text & Email order updates; 2-Day FedEx/UPS standard with low-cost overnight
Largest Variety of peptides & bioregulators

Potential Applications in Research (RUO)

Strictly for laboratory research. No health, diagnostic, or therapeutic claims.

Membrane disruption models — quantify peptide-induced leakage in lipid vesicles/bacterial-mimetic bilayers; relate to amphipathic helix features reported for LL-37 and fragments (e.g., KR-12). :contentReference[oaicite:0]{index=0}
Receptor/chemotaxis assays — evaluate FPRL1/FPR2-dependent signaling using HEK293-FPRL1 cells and primary immune cells (Ca²⁺ mobilization, migration). :contentReference[oaicite:1]{index=1}
LPS/TLR pathway readouts — test LPS neutralization and TLR2/TLR4 reporter inhibition under defined conditions (e.g., HEK-Blue systems). :contentReference[oaicite:2]{index=2}
Epithelial wound-closure models — determine effects on scratch assays and proliferation in airway epithelial cell lines with standardized serum/EGFR pathway controls. :contentReference[oaicite:3]{index=3}
Analytical method development — implement stability-indicating RP-HPLC/LC–MS(/MS) for identity, purity, recovery, and forced-degradation across buffers and temperatures (general SOPs; peptide-specific parameters validated per lot COA).

Citations (selected)

Yang, Dawei, et al. “LL-37, the Neutrophil Granule– and Epithelial Cell–Derived Cathelicidin, Utilizes FPRL1 as a Receptor to Chemoattract Human Peripheral Blood Neutrophils, Monocytes, and T Cells.” Journal of Experimental Medicine 192.7 (2000): 1069–1074. Link. :contentReference[oaicite:4]{index=4}
Vandamme, Dries, et al. “Human Endogenous Antibiotic LL-37 Stimulates Airway Epithelial Cell Proliferation and Wound Closure.” American Journal of Physiology-Lung Cellular and Molecular Physiology 289.5 (2005): L842–L852. PDF. :contentReference[oaicite:5]{index=5}
Wang, Guangshun, et al. “Structures of Human Host Defense Cathelicidin LL-37 and Its Smallest Antimicrobial Peptide KR-12 in Lipid Micelles.” Journal of Biological Chemistry 283.47 (2008): 32637–32643. PDB 2K6O. :contentReference[oaicite:6]{index=6}
InvivoGen. “LL-37 / hCAP18: Antimicrobial Peptide.” Product page/specifications including TLR2/TLR4 reporter validation. Link. :contentReference[oaicite:7]{index=7}

Quality, Storage & Handling

Every lot is confirmed by HPLC (purity) and MS (identity); the on-vial QR links to the batch COA. Independent U.S. labs verify purity, quantity, and endotoxin.

Storage (lyophilized): −20 °C long-term or 2–8 °C short-term; keep desiccated and protected from light.
After reconstitution: Aliquot and store at ≤ −20 °C (or −80 °C per SOP); avoid repeated freeze–thaw cycles.
Reconstitution tips: Use sterile water or suitable buffer; gently swirl/invert to dissolve. If sterility is required, 0.22 µm filter and aliquot promptly.

Shipping & Fulfillment

Ships with validated cold-chain packaging. In-stock orders placed before the daily cutoff ship the same day. 2-Day FedEx/UPS is standard, with overnight options available. Automated text/email updates included; international shipping available where permitted.

Compliance & RUO Disclaimer

For laboratory research only. Not a drug, cosmetic, food, or household chemical. Not for human or animal use, ingestion, diagnostic, or therapeutic applications. Purchasers warrant appropriate qualifications and compliance with applicable regulations and institutional policies.

FAQs

Is LL-37 the only human cathelicidin?: Yes—the CAMP gene encodes the precursor (hCAP18) from which the active 37-mer LL-37 is generated; LL-37 is the sole human cathelicidin. :contentReference[oaicite:8]{index=8}
Do you provide a PubChem image?: Yes—the 2D structure above is rendered from PubChem CID 16198951 for LL-37. (Identifier also listed by multiple reagent databases.) :contentReference[oaicite:9]{index=9}
What purity do you provide?: Each 10 mg vial is ≥99% by HPLC with MS identity confirmation; third-party testing is performed on every lot (COA via on-vial QR).
How should I reconstitute it?: Dissolve in sterile water or a compatible buffer; gently invert until fully dissolved. If your SOP requires sterility, 0.22 µm filter and aliquot to avoid repeat freeze–thaw.