VIP 10 mg (Vasoactive Intestinal Peptide; human VIP₂₈) from Peptide Tech is a premium, lyophilized research-use-only (RUO) peptide produced at ≥99% purity (HPLC & MS verified). This 28-residue neuropeptide is formatted for reproducible in-vitro work in GPCR pharmacology (VPAC1/VPAC2), cAMP signaling, epithelial-barrier models, and analytical method development—backed by batch traceability, third-party testing, and validated cold-chain logistics.

Specifications

Property	Details
Product	Vasoactive Intestinal Peptide (VIP) — lyophilized peptide, 10 mg
Chemical Name	Human VIP₂₈ (H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH₂)
Synonyms	Vasoactive Intestinal Polypeptide; VIP (human)
Sequence	HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH₂ (28 aa)
CAS Number	37221-79-7
PubChem CID	16132300
Molecular Formula	C₁₄₇H₂₃₇N₄₃O₄₃S
Molecular Weight	≈ 3326.8 g/mol
Appearance	White to off-white lyophilized powder
Content per Vial	10 mg
Container	3 mL Type I glass vial; butyl stopper; flip-off seal
Purity / Identity	≥99% by HPLC; identity by MS (batch COA via on-vial QR)
Counter-ion	Typically acetate (verify on lot COA)
Solubility	Soluble in sterile water or neutral buffers; for higher concentrations, pre-wet with ≤0.1% acetic acid then bring to final buffer. If sterility is required by your SOP, 0.22 µm filter after dissolution.
Storage (lyophilized)	−20 °C long-term; store desiccated and protected from light.
After Reconstitution	Aliquot and store at ≤ −20 °C (or −80 °C per SOP); avoid repeat freeze–thaw cycles.
Intended Use	RUO only. Not for human or animal use.

Molecular Structure

Vasoactive Intestinal Peptide (VIP) 2D structure — PubChem CID 16132300 — View VIP on PubChem (CID 16132300)

Key Features of Peptide Tech

Same-Day Shipping (Mon–Fri, on in-stock items)
GMP-Aligned lyophilization & documentation
USA-Made peptides
24/7 Support & Price Match Guarantee
Batch QR for instant COA & chain-of-custody verification
3rd-Party U.S. Lab Testing — purity, quantity, endotoxin
Cold-Chain Shipping — Always (no paid upgrade)
Worldwide Shipping; all major payments accepted
Text & Email order updates; 2-Day FedEx/UPS standard with low-cost overnight
Largest Variety of peptides & bioregulators

Potential Applications in Research (RUO)

Strictly for laboratory research. No health, diagnostic, or therapeutic claims.

VPAC1/VPAC2 GPCR pharmacology — quantify VIP-evoked cAMP accumulation and β-arrestin recruitment in heterologous or native cell systems expressing human VPAC1/VPAC2; build concentration–response curves and compare receptor selectivity of analogs and antagonists. :contentReference[oaicite:0]{index=0}
Epithelial-barrier models — evaluate VIP’s effects on tight-junction readouts (e.g., TEER, claudins/occludin expression) in intestinal or airway epithelial monolayers; pair with VPAC1 localization along the gut for mechanistic context. :contentReference[oaicite:1]{index=1}
Immunomodulation panels — profile cytokine/chemokine outputs (e.g., IL-6, TNF-α, IL-10) from macrophage or T-cell cultures under defined stimuli to map VIP-dependent pathway signatures. :contentReference[oaicite:2]{index=2}
Vascular signaling assays — in cultured endothelial/smooth-muscle models, monitor cAMP/PKA activation and downstream markers to dissect mechanisms underlying VIP-linked vasodilatory pathways in vitro. :contentReference[oaicite:3]{index=3}
Analytical method development — establish stability-indicating RP-HPLC and LC–MS(/MS) methods for identity, purity, recovery, and forced-degradation studies across buffers and temperatures; confirm counter-ion content by ion chromatography as needed.

Citations (selected)

Iwasaki, Masahide, Yasutada Akiba, and John D. Kaunitz. “Recent Advances in Vasoactive Intestinal Peptide Physiology and Pathophysiology: Focus on the Gastrointestinal System.” F1000Research, vol. 8, 2019, Faculty Rev-1629. https://doi.org/10.12688/f1000research.18039.1. :contentReference[oaicite:4]{index=4}
Jayawardena, Dinushka, et al. “Expression and Localization of VPAC1, the Major Receptor of Vasoactive Intestinal Peptide along the Length of the Intestine.” American Journal of Physiology–Gastrointestinal and Liver Physiology, vol. 313, no. 1, 2017, pp. G16–G25. https://doi.org/10.1152/ajpgi.00081.2017. :contentReference[oaicite:5]{index=5}
Delgado, Mario, et al. “Vasoactive Intestinal Peptide in the Immune System: Potential Therapeutic Role in Inflammatory and Autoimmune Diseases.” Journal of Molecular Medicine, vol. 80, no. 1, 2002, pp. 16–24. https://doi.org/10.1007/s00109-001-0291-5. :contentReference[oaicite:6]{index=6}
Wilkins, Bradley W., et al. “Mechanisms of Vasoactive Intestinal Peptide–Mediated Vasodilation in Human Skin.” Journal of Applied Physiology, vol. 97, no. 4, 2004, pp. 1291–1298. https://doi.org/10.1152/japplphysiol.00366.2004. :contentReference[oaicite:7]{index=7}

Quality, Storage & Handling

Every lot is confirmed by HPLC (purity) and MS (identity); the on-vial QR links to the batch COA. Independent U.S. labs verify purity, quantity, and endotoxin.

Reconstitution: Bring vial to room temperature; add sterile water or buffer along the vial wall and gently swirl/invert. Avoid vigorous vortexing; brief, low-energy sonication can help stubborn pellets.
Aliquoting: Prepare single-use aliquots immediately after dissolving; minimize freeze–thaw exposure.
Controls: Include receptor-negative cells, selective antagonists, or scrambled-sequence controls per your SOP for mechanistic interpretation.

Shipping & Fulfillment

Ships with validated cold-chain packaging. In-stock orders placed before the daily cutoff ship the same day. 2-Day FedEx/UPS is standard, with overnight options available. Automated text/email updates included; international shipping available where permitted.

Compliance & RUO Disclaimer

For laboratory research only. Not a drug, cosmetic, food, or household chemical. Not for human or animal use, ingestion, diagnostic, or therapeutic applications. Purchasers warrant appropriate qualifications and compliance with applicable regulations and institutional policies.

FAQs

Is this human VIP?: Yes—this listing is the human 28-aa VIP sequence with a C-terminal amide (see sequence above).
What purity do you provide?: Each 10 mg vial is ≥99% by HPLC with MS identity; third-party U.S. labs test every lot (COA via on-vial QR).
Do you provide a PubChem structure image?: Yes—the image above is rendered from PubChem CID 16132300; click the caption to view the PubChem record.